Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse (His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse-his.html

Purity

98.0

Smiles

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (P2-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

U2 snRNP B'' shRNA Plasmid (h)
sc-76782-SH 20 µg

U2 snRNP B'' shRNA Plasmid (h)

Sign In for Pricing
View Details
VH 032 amide-alkylC6-acid
HY-44630-01 50 mg

VH 032 amide-alkylC6-acid

Sign In for Pricing
View Details
VH 032 amide-alkylC6-acid
HY-44630-02 100 mg

VH 032 amide-alkylC6-acid

Sign In for Pricing
View Details
VH 032 amide-alkylC6-acid
HY-44630-03 250 mg

VH 032 amide-alkylC6-acid

Sign In for Pricing
View Details
VH 032 amide-alkylC6-acid
HY-44630-04 1 g

VH 032 amide-alkylC6-acid

Sign In for Pricing
View Details
FREM2 Antibody
orb417163-01 50 µg

FREM2 Antibody

Sign In for Pricing
View Details