Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse (His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse-his.html

Purity

98.0

Smiles

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (P2-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipoxin A4, 15-epi
sc-202695 25 µg

Lipoxin A4, 15-epi

Sign In for Pricing
View Details
Ankrd40 (NM_001134699) Rat Tagged Lenti ORF Clone
RR205360L4 10 µg

Ankrd40 (NM_001134699) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phostensin (PPP1R18) Human shRNA Plasmid Kit (Locus ID 170954)
TL318053 1 Kit

Phostensin (PPP1R18) Human shRNA Plasmid Kit (Locus ID 170954)

Sign In for Pricing
View Details
Ccnt2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15414154 3x 1.0 µg DNA

Ccnt2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Cenpm (NM_025639) Mouse Tagged ORF Clone
MG223619 10 µg

Cenpm (NM_025639) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
POLYART CHARTS, Human Reproductive Organs, Male
4060250/3 1 Each

POLYART CHARTS, Human Reproductive Organs, Male

Sign In for Pricing
View Details