Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Specifications

Product Name Alternative

(Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)

Abbreviation

Recombinant Human IL12B protein

Gene Name

IL12B

UniProt

P29460

Expression Region

23-328aa

Organism

Homo sapiens (Human)

Target Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.8 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-01 20 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-02 100 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-03 500 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-04 1 mg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Tmem116 (NM_029912) Mouse Tagged ORF Clone
MG202244 10 µg

Tmem116 (NM_029912) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Genomic DNA, Lymphoid tissue
CD564738 5 µg

Tissue Genomic DNA, Lymphoid tissue

Sign In for Pricing
View Details