Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human adenovirus C serotype 2 DNA-binding protein (DBP), partial

Product Specifications

Product Name Alternative

(DBP) (Early 2A protein) (Early E2A DNA-binding protein)

Abbreviation

Recombinant Human adenovirus C serotype 2 DBP protein, partial

Gene Name

DBP

UniProt

P03264

Expression Region

174-529aa

Organism

Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)

Target Sequence

SLPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its release from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.8 kDa

References & Citations

"Adenovirus DNA binding protein inhibits SrCap-activated CBP and CREB-mediated transcription." Xu X., Tarakanova V., Chrivia J., Yaciuk P. Virology 313:615-621 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details