Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS2, Human (HEK293, His)

The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (HEK293, His) is the recombinant human-derived PRPS2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRPS2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prps2-protein-human-hek-293-his.html

Smiles

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Molecular Formula

5634 (Gene_ID) P11908-1 (P2-L318) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ankrd33 Mouse siRNA Oligo Duplex (Locus ID 208258)
SR411332 1 Kit

Ankrd33 Mouse siRNA Oligo Duplex (Locus ID 208258)

Ask
View Details
Triticum vulgare (WGA, Wheat germ) (Biotin)
MBS656402-01 1 mg

Triticum vulgare (WGA, Wheat germ) (Biotin)

Ask
View Details
Triticum vulgare (WGA, Wheat germ) (Biotin)
MBS656402-02 5 mg

Triticum vulgare (WGA, Wheat germ) (Biotin)

Ask
View Details
Triticum vulgare (WGA, Wheat germ) (Biotin)
MBS656402-03 5x 5 mg

Triticum vulgare (WGA, Wheat germ) (Biotin)

Ask
View Details
CPXCR1 Blocking Peptide
33R-9933 100 ug

CPXCR1 Blocking Peptide

Ask
View Details
Phospho-STAT1 Antibody FITC
MBS544524-01 0.1 mg

Phospho-STAT1 Antibody FITC

Ask
View Details