Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS2, Human (HEK293, His)

The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (HEK293, His) is the recombinant human-derived PRPS2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRPS2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prps2-protein-human-hek-293-his.html

Smiles

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Molecular Formula

5634 (Gene_ID) P11908-1 (P2-L318) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Retinoid X Receptor, gamma Antibody
abx115161 100 µL

Retinoid X Receptor, gamma Antibody

Ask
View Details
Lysyl Oxidase Homolog 1, Recombinant, Human, aa106-574, His-Tag
585258-01 20 µg

Lysyl Oxidase Homolog 1, Recombinant, Human, aa106-574, His-Tag

Ask
View Details
Lysyl Oxidase Homolog 1, Recombinant, Human, aa106-574, His-Tag
585258-02 100 µg

Lysyl Oxidase Homolog 1, Recombinant, Human, aa106-574, His-Tag

Ask
View Details
Horse Reelin ELISA Kit
MBS070137-01 48 Well

Horse Reelin ELISA Kit

Ask
View Details
Horse Reelin ELISA Kit
MBS070137-02 96 Well

Horse Reelin ELISA Kit

Ask
View Details
Horse Reelin ELISA Kit
MBS070137-03 5x 96 Well

Horse Reelin ELISA Kit

Ask
View Details