Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Varicella-zoster virus Envelope glycoprotein L (gL)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Varicella-zoster virus gL protein

Gene Name

GL

UniProt

Q9J3N1

Expression Region

23-160aa

Organism

Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)

Target Sequence

LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLTQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

References & Citations

"A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL." Xing Y., Oliver S.L., Nguyen T., Ciferri C., Nandi A., Hickman J., Giovani C., Yang E., Palladino G., Grose C., Uematsu Y., Lilja A.E., Arvin A.M., Carfi A. Proc. Natl. Acad. Sci. U.S.A. 112:6056-6061 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tolfenamic Acid EP Impurity B
RM-T151402-01 10 mg

Tolfenamic Acid EP Impurity B

Ask
View Details
Tolfenamic Acid EP Impurity B
RM-T151402-02 25 mg

Tolfenamic Acid EP Impurity B

Ask
View Details
Tolfenamic Acid EP Impurity B
RM-T151402-03 50 mg

Tolfenamic Acid EP Impurity B

Ask
View Details
Tolfenamic Acid EP Impurity B
RM-T151402-04 100 mg

Tolfenamic Acid EP Impurity B

Ask
View Details
GABRE, NT (GABRE, Gamma-aminobutyric acid receptor subunit epsilon, GABA(A) receptor subunit epsilon) (FITC)
MBS6300887-01 0.2 mL

GABRE, NT (GABRE, Gamma-aminobutyric acid receptor subunit epsilon, GABA(A) receptor subunit epsilon) (FITC)

Ask
View Details
GABRE, NT (GABRE, Gamma-aminobutyric acid receptor subunit epsilon, GABA(A) receptor subunit epsilon) (FITC)
MBS6300887-02 5x 0.2 mL

GABRE, NT (GABRE, Gamma-aminobutyric acid receptor subunit epsilon, GABA(A) receptor subunit epsilon) (FITC)

Ask
View Details