Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2T, Human (His)

UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2T Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2t-protein-human-his.html

Purity

95.02

Smiles

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Molecular Formula

29089 (Gene_ID) Q9NPD8 (M1-V197) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription Factor JunB (JUNB) Antibody
abx113294 100 µL

Transcription Factor JunB (JUNB) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cul5 shRNA (UAS) - Lentiviral mouse Cul5 shRNA (UAS, GFP) plasmid
GTR15141694 1 Vial

Lentiviral mouse Cul5 shRNA (UAS) - Lentiviral mouse Cul5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
meta-Fexofenadine-D6
TRC-F322482-50MG 50 mg

meta-Fexofenadine-D6

Sign In for Pricing
View Details
C6orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0243408 1.0 µg DNA

C6orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Microtubule-Associated Tumor Suppressor 1 (MTUS1) ELISA Kit
MBS9919047-01 48 Well

Mouse Microtubule-Associated Tumor Suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Microtubule-Associated Tumor Suppressor 1 (MTUS1) ELISA Kit
MBS9919047-02 96 Well

Mouse Microtubule-Associated Tumor Suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details