Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2T, Human (His)

UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2T Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2t-protein-human-his.html

Purity

95.02

Smiles

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Molecular Formula

29089 (Gene_ID) Q9NPD8 (M1-V197) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-SHOX antibody
STJ11100710 50 µl

Anti-SHOX antibody

Ask
View Details
Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)
MBS8424030-01 0.12 mL

Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)

Ask
View Details
Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)
MBS8424030-02 0.2 mL

Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)

Ask
View Details
Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)
MBS8424030-03 5x 0.2 mL

Rabbit Anti Human IMPA1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, ELISA)

Ask
View Details
Rabbit Polyclonal Caspase-2 Antibody
NBP2-26612-0.1mg 0.1 mg

Rabbit Polyclonal Caspase-2 Antibody

Ask
View Details
Di-2-thienylglycolic acid
sc-497270 250 mg

Di-2-thienylglycolic acid

Ask
View Details