Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2T, Human (His)

UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2T Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2t-protein-human-his.html

Purity

95.02

Smiles

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Molecular Formula

29089 (Gene_ID) Q9NPD8 (M1-V197) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Human IgG (biotin)
43R-1187 2 mg

Goat anti Human IgG (biotin)

Sign In for Pricing
View Details
Contactin 3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2404172 100 µL

Contactin 3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Human Spinal Cord Lysate Membrane Fraction
IHUSNCTLM100UG 1 Each

Human Spinal Cord Lysate Membrane Fraction

Sign In for Pricing
View Details
Ulcine-d3 Bromide
167022 2.5 mg

Ulcine-d3 Bromide

Sign In for Pricing
View Details
Quick Step Rat connective tissue growth factor, CTGF ELISA Kit
QS0196Ra-01 48 Tests

Quick Step Rat connective tissue growth factor, CTGF ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat connective tissue growth factor, CTGF ELISA Kit
QS0196Ra-02 96 Tests

Quick Step Rat connective tissue growth factor, CTGF ELISA Kit

Sign In for Pricing
View Details