COX4I1, Human (His-SUMO)
The COX4I1 protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. COX4I1 Protein, Human (His-SUMO) is the recombinant human-derived COX4I1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
COX4I1 Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cox4i1-protein-human-his-sumo.html
Smiles
AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Molecular Formula
1327 (Gene_ID) P13073 (A23-K169) (Accession)
Molecular Weight
Approximately 33.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Recombinant Rat Uncharacterized protein C14orf79 homolog
Recombinant Rat Uncharacterized protein C14orf79 homolog
Recombinant Rat Uncharacterized protein C14orf79 homolog
Recombinant Rat Uncharacterized protein C14orf79 homolog