Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lens culinaris Lectin, partial

Product Specifications

Abbreviation

Recombinant Lens culinaris Lectin protein, partial

UniProt

P02870

Expression Region

31-210aa

Organism

Lens culinaris (Lentil) (Cicer lens)

Target Sequence

TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

D-mannose specific lectin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.3 kDa

References & Citations

"NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction." Casset F., Hamelryck T., Loris R., Brisson J.R., Tellier C., Dao-Thi M.H., Wyns L., Poortmans F., Perez S., Imberty A. J. Biol. Chem. 270:25619-25628 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Dystroglycan 1 (DAG1) ELISA Kit
EIA07311Rb 1 Kit

Rabbit Dystroglycan 1 (DAG1) ELISA Kit

Sign In for Pricing
View Details
PF4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36422154 3x 1.0 µg DNA

PF4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
SNTB2 Antibody - middle region : FITC (ARP62913_P050-FITC)
ARP62913_P050-FITC 100 µL

SNTB2 Antibody - middle region : FITC (ARP62913_P050-FITC)

Sign In for Pricing
View Details
Anti-MTERFD3 Antibody
MBS8292617-01 0.03 mL

Anti-MTERFD3 Antibody

Sign In for Pricing
View Details
Anti-MTERFD3 Antibody
MBS8292617-02 0.05 mL

Anti-MTERFD3 Antibody

Sign In for Pricing
View Details
Anti-MTERFD3 Antibody
MBS8292617-03 0.1 mL

Anti-MTERFD3 Antibody

Sign In for Pricing
View Details