Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lens culinaris Lectin, partial

Product Specifications

Abbreviation

Recombinant Lens culinaris Lectin protein, partial

UniProt

P02870

Expression Region

31-210aa

Organism

Lens culinaris (Lentil) (Cicer lens)

Target Sequence

TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

D-mannose specific lectin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.3 kDa

References & Citations

"NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction." Casset F., Hamelryck T., Loris R., Brisson J.R., Tellier C., Dao-Thi M.H., Wyns L., Poortmans F., Perez S., Imberty A. J. Biol. Chem. 270:25619-25628 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit
BSKR65976-01 48 Tests

Rat Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit

Sign In for Pricing
View Details
Rat Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit
BSKR65976-02 96 Tests

Rat Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Chicken IgG (H+L) Secondary Antibody [PE/Cy5.5]
NBP1-72720PECY55 0.5 mL

Goat Polyclonal Goat anti-Chicken IgG (H+L) Secondary Antibody [PE/Cy5.5]

Sign In for Pricing
View Details
Anti-NR1D1  (2A5)
YF-MA16923 200 ul

Anti-NR1D1 (2A5)

Sign In for Pricing
View Details
MMP2 Rabbit Polyclonal Antibody
orb1292528-01 50 µg

MMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP2 Rabbit Polyclonal Antibody
orb1292528-02 100 µg

MMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details