Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcellio dilatatus Androgenic gland hormone (AGH), partial

Product Specifications

Product Name Alternative

(Pod-AGH)

Abbreviation

Recombinant Porcellio dilatatus AGH protein, partial

Gene Name

AGH

UniProt

Q86SA8

Expression Region

22-65aa

Organism

Porcellio dilatatus (Woodlouse)

Target Sequence

YQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

6.6 kDa

References & Citations

"Molecular cloning and expression analysis of cDNAs encoding androgenic gland hormone precursors from two porcellionidae species, Porcellio scaber and P. dilatatus." Ohira T., Hasegawa Y., Tominaga S., Okuno A., Nagasawa H. Zool. Sci. 20:75-81 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) OST2 Polyclonal Antibody
MBS7159111 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) OST2 Polyclonal Antibody

Sign In for Pricing
View Details
Diosmetine Tri-O-benzoyl
MBS6034462-01 5 mg

Diosmetine Tri-O-benzoyl

Sign In for Pricing
View Details
Diosmetine Tri-O-benzoyl
MBS6034462-02 5x 5 mg

Diosmetine Tri-O-benzoyl

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)
MBS1116343-01 0.02 mg (E-Coli)

Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)
MBS1116343-02 0.1 mg (E-Coli)

Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)
MBS1116343-03 0.02 mg (Yeast)

Recombinant Mycobacterium ulcerans RNA polymerase sigma factor sigK (sigK)

Sign In for Pricing
View Details