Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD53, Cynomolgus (HEK293, His)

CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD53 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd53-protein-cynomolgus-hek293-his.html

Purity

96.00

Smiles

EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSN

Molecular Formula

102127943 (Gene_ID) G7NW46 (E107-N181) (Accession)

Molecular Weight

Approximately 17-23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-04 0.1 mg (Yeast)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-05 0.02 mg (Baculovirus)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1162071-06 0.02 mg (Mammalian-Cell)

Recombinant Xylella fastidiosa UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details