Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rat (HEK293, His)

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins[1][2][3]. CD79B Protein, Rat (HEK293, His) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rat-hek293-his.html

Purity

98.00

Smiles

VPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

171055 (Gene_ID) O70153 (V26-D158) (Accession)

Molecular Weight

Approximately 25-30 kDa due to the glycosylation.

References & Citations

[1]Lisa Patrone, et al. A conserved sequence upstream of the B29 (Ig beta, CD79b) gene interacts with YY1. Mol Biol Rep. 2004 Mar;31 (1) :1-11.|[2]S Nakazato, et al. Physical linkage of the B29/Ig-beta (CD79B) gene to the skeletal muscle, sodium-channel, and growth hormone genes in rat and human. Genomics. 1998 Mar 15;48 (3) :363-8.|[3]Kanutte Huse, et al. Mechanism of CD79A and CD79B Support for IgM+ B Cell Fitness through B Cell Receptor Surface Expression. J Immunol. 2022 Nov 15;209 (10) :2042-2053.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details
Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-02 0.02 mg (Yeast)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details
Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-03 0.1 mg (E-Coli)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details
Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-04 0.1 mg (Yeast)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details
Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details
Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)
MBS1283685-06 0.02 mg (Mammalian-Cell)

Recombinant Shigella flexneri UPF0061 protein ydiU (ydiU)

Ask
View Details