CD79B, Rat (HEK293, His)

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins[1][2][3]. CD79B Protein, Rat (HEK293, His) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rat-hek293-his.html

Purity

98.00

Smiles

VPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

171055 (Gene_ID) O70153 (V26-D158) (Accession)

Molecular Weight

Approximately 25-30 kDa due to the glycosylation.

References & Citations

[1]Lisa Patrone, et al. A conserved sequence upstream of the B29 (Ig beta, CD79b) gene interacts with YY1. Mol Biol Rep. 2004 Mar;31 (1) :1-11.|[2]S Nakazato, et al. Physical linkage of the B29/Ig-beta (CD79B) gene to the skeletal muscle, sodium-channel, and growth hormone genes in rat and human. Genomics. 1998 Mar 15;48 (3) :363-8.|[3]Kanutte Huse, et al. Mechanism of CD79A and CD79B Support for IgM+ B Cell Fitness through B Cell Receptor Surface Expression. J Immunol. 2022 Nov 15;209 (10) :2042-2053.