Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptoporin (Synpr)

Product Specifications

Abbreviation

Recombinant Rat Synpr protein

Gene Name

Synpr

UniProt

P22831

Expression Region

1-265aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSGGYSQQASLGPTSDEFGQQPSGPTSFNNQI

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.2 kDa

References & Citations

"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bmp8b activation kit by CRISPRa
GA200424 1 Kit

Mouse Bmp8b activation kit by CRISPRa

Sign In for Pricing
View Details
Zp2 Mouse Gene Knockout Kit (CRISPR)
KN520134 1 Kit

Zp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Vitronectin Antibody
RC-3842-01 50 μL

Recombinant Vitronectin Antibody

Sign In for Pricing
View Details
Recombinant Vitronectin Antibody
RC-3842-02 100 µL

Recombinant Vitronectin Antibody

Sign In for Pricing
View Details
Recombinant Vitronectin Antibody
RC-3842-03 1 mL

Recombinant Vitronectin Antibody

Sign In for Pricing
View Details
Rat NRP2 Antibody Pair Set
E-KAB-0387 50 µL & 100 µg

Rat NRP2 Antibody Pair Set

Sign In for Pricing
View Details