Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS, Human (HEK293, Fc)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

ICOS Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icos-protein-human-hek-293-fc.html

Purity

97.43

Smiles

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Molecular Formula

29851 (Gene_ID) Q9Y6W8-1 (E21-F141) (Accession)

Molecular Weight

Approximately 47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details