Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS, Human (HEK293, Fc)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

ICOS Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icos-protein-human-hek-293-fc.html

Purity

97.43

Smiles

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Molecular Formula

29851 (Gene_ID) Q9Y6W8-1 (E21-F141) (Accession)

Molecular Weight

Approximately 47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL17P23-set siRNA/shRNA/RNAi Lentivector (Human)
40886091 4x 500 ng

RPL17P23-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
FAM204A Adenovirus (Human)
19924051 1.0 mL

FAM204A Adenovirus (Human)

Sign In for Pricing
View Details
Centrosomal protein of 55 kDa Antibody (Fluoro488)
orb3165281 100 µg

Centrosomal protein of 55 kDa Antibody (Fluoro488)

Sign In for Pricing
View Details
Human LRRC37A Pre-designed siRNA Set B
SI008897B 1 Each

Human LRRC37A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human BICD1 siRNA
abx909101-01 15 nmol

Human BICD1 siRNA

Sign In for Pricing
View Details
Human BICD1 siRNA
abx909101-02 30 nmol

Human BICD1 siRNA

Sign In for Pricing
View Details