Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N, solution)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (K128N, solution), consists of 155 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-human-k128n.html

Purity

99.90

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-2/BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyr
MBS6472072-01 0.1 mL

DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyr

Sign In for Pricing
View Details
DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyr
MBS6472072-02 5x 0.1 mL

DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyr

Sign In for Pricing
View Details
SNORD115-21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2243508 1.0 µg DNA

SNORD115-21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DDT siRNA (Rat)
CRR1075-01 15 nmol

DDT siRNA (Rat)

Sign In for Pricing
View Details
DDT siRNA (Rat)
CRR1075-02 30 nmol

DDT siRNA (Rat)

Sign In for Pricing
View Details
Magnesium carbonate
sc-215278A 1 Kg

Magnesium carbonate

Sign In for Pricing
View Details