Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P53, Rat (His)

The p53 protein acts as a tumor suppressor, regulates the cell cycle and induces growth arrest or apoptosis.It activates genes that inhibit cell division and trigger apoptosis by controlling the expression of various proteins.p53 Protein, Rat (His) is the recombinant rat-derived p53 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

P53 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/p53-protein-rat-his.html

Purity

94.00

Smiles

MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

Molecular Formula

24842 (Gene_ID) P10361 (M1-D391) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910) (AP)
MBS6134108-01 0.1 mL

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910) (AP)

Ask
View Details
TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910) (AP)
MBS6134108-02 5x 0.1 mL

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910) (AP)

Ask
View Details
Human ADGRG5 Knockout A549 cell line
GTR15409292 1 Vial

Human ADGRG5 Knockout A549 cell line

Ask
View Details
CD68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12A3]
TA802965BM 100 µL

CD68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12A3]

Ask
View Details
Tenascin C (TNC) Antibody
abx403813-01 100 µL

Tenascin C (TNC) Antibody

Ask
View Details
Tenascin C (TNC) Antibody
abx403813-02 200 µL

Tenascin C (TNC) Antibody

Ask
View Details