IL-10R beta, Human (HEK293, His)
IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses.IL-10R beta Protein, Human (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W221-F242) with a 6*His tag at the C-terminus[3].
Product Specifications
Product Name Alternative
IL-10R beta Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10r-beta-protein-human-201a-a-hek293-his.html
Purity
95.0
Smiles
MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Molecular Formula
3588 (Gene_ID) Q08334/NP_000619.3 (M20-S220) (Accession)
Molecular Weight
Approximately 48 kDa
References & Citations
[1]Sung-Il Yoon, et al. Structure and mechanism of receptor sharing by the IL-10R2 common chain. Structure. 2010 May 12;18 (5) :638-48.|[2]J Shi, et al. IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways. Cell Death Dis. 2016 Mar 10;7 (3) :e2133.|[3]Paul Sheppard, et al. IL-28, IL-29 and their class II cytokine receptor IL-28R. Nat Immunol. 2003 Jan;4 (1) :63-8.|[4]L. Zhou, et al. Activation of toll-like receptor-3 induces interferon-lambda expression in human neuronal cells. Neuroscience. 2009 Mar 17;159 (2) :629-37.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-425663-LAC 200 µL
Neurogranin Lentiviral Activation Particles (m)
Sign In for Pricing
View Details 132541-ML650 100 µL
RGS5 (Regulator of G-Protein Signaling 5, Regulator of G-Protein Signaling 5, RGS-5, MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129) (MaxLight 650)
Sign In for Pricing
View Details