Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIM-3/HAVCR2, Mouse (HEK293, hFc)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TIM-3/HAVCR2 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tim-3-havcr2-protein-mouse-hek-293-hfc.html

Purity

90.00

Smiles

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Molecular Formula

171285 (Gene_ID) Q8VIM0-1 (R20-R191) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isonicotinamide-d4
TRC-I821702-10MG 10 mg

Isonicotinamide-d4

Sign In for Pricing
View Details
Vmn2r53 Mouse Gene Knockout Kit (CRISPR)
KN519183 1 Kit

Vmn2r53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPP1R14D Antibody
KC-616-01 50 μL

PPP1R14D Antibody

Sign In for Pricing
View Details
PPP1R14D Antibody
KC-616-02 100 µL

PPP1R14D Antibody

Sign In for Pricing
View Details
PPP1R14D Antibody
KC-616-03 1 mL

PPP1R14D Antibody

Sign In for Pricing
View Details
MYCN Polyclonal Antibody
E-AB-13462-01 20 µL

MYCN Polyclonal Antibody

Sign In for Pricing
View Details