Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Glycine cleavage system H protein, mitochondrial (GCSH)

Product Specifications

Product Name Alternative

(Lipoic acid-containing protein)

Abbreviation

Recombinant Chicken GCSH protein

Gene Name

GCSH

UniProt

P11183

Expression Region

40-164aa

Organism

Gallus gallus (Chicken)

Target Sequence

SARKFTDKHEWISVENGIGTVGISNFAQEALGDVVYCSLPEIGTKLNKDDEFGALESVKAASELYSPLTGEVTDINAALADNPGLVNKSCYQDGWLIKMTVEKPAELDELMSEDAYEKYIKSIED

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

The glycine cleavage system catalyzes the degradation of glycine. The H protein (GCSH) shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.7 kDa

References & Citations

"Chicken liver H-protein, a component of the glycine cleavage system. Amino acid sequence and identification of the N epsilon-lipoyllysine residue." Fujiwara K., Okamura-Ikeda K., Motokawa Y. J. Biol. Chem. 261:8836-8841 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human OR2G6 activation kit by CRISPRa
GA118209 1 Kit

Human OR2G6 activation kit by CRISPRa

Ask
View Details
NFE2L1, CT (NFE2L1, HBZ17, NRF1, TCF11, Nuclear factor erythroid 2-related factor 1, Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor 11, Transcription factor HBZ17, Transcription factor LCR-F1) (PE)
MBS6324981-01 0.2 mL

NFE2L1, CT (NFE2L1, HBZ17, NRF1, TCF11, Nuclear factor erythroid 2-related factor 1, Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor 11, Transcription factor HBZ17, Transcription factor LCR-F1) (PE)

Ask
View Details
NFE2L1, CT (NFE2L1, HBZ17, NRF1, TCF11, Nuclear factor erythroid 2-related factor 1, Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor 11, Transcription factor HBZ17, Transcription factor LCR-F1) (PE)
MBS6324981-02 5x 0.2 mL

NFE2L1, CT (NFE2L1, HBZ17, NRF1, TCF11, Nuclear factor erythroid 2-related factor 1, Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor 11, Transcription factor HBZ17, Transcription factor LCR-F1) (PE)

Ask
View Details
TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14)
494246 100 µL

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14)

Ask
View Details