Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP BDNF, Human

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt) [1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. GMP BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

Product Specifications

Product Name Alternative

GMP BDNF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-bdnf-protein-human.html

Smiles

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Formula

627 (Gene_ID) P23560-1 (H129-R247) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (421) [CoraFluor 1]
NBP2-89594CL1 0.1 mL

Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (421) [CoraFluor 1]

Ask
View Details
Mouse Anti-Chicken Major Histocompatibility Complex (MHC) Class I Monoclonal Antibody
VD7N262 1 Each

Mouse Anti-Chicken Major Histocompatibility Complex (MHC) Class I Monoclonal Antibody

Ask
View Details
Betahistine 2HCl
C17234 10 mM / 1 mL

Betahistine 2HCl

Ask
View Details
CD283 / TLR3 Mouse Monoclonal Antibody [Clone ID: 1205C5F1 / TLR3.1]
DDX0478A488-100 100 µg

CD283 / TLR3 Mouse Monoclonal Antibody [Clone ID: 1205C5F1 / TLR3.1]

Ask
View Details