Claudin-6/CLDN6-VLP, Human (Biotinylated, HEK293)
Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293) is recommended only for SPR analysis. HY-P77899 can be used in animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
Product Specifications
Product Name Alternative
Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/claudin-6-cldn6-protein-vlp-human-biotinylated-hek293.html
Purity
95.0
Smiles
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Molecular Formula
9074 (Gene_ID) P56747 (M1-V220) (Accession)
Molecular Weight
Approximately 24.5 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0281908 1.0 µg DNA
C10orf137 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MBS1307843-01 0.02 mg (E-Coli)
Recombinant Bovine Pre-mRNA-splicing factor RBM22 (RBM22)
Sign In for Pricing
View Details MBS1307843-02 0.02 mg (Yeast)
Recombinant Bovine Pre-mRNA-splicing factor RBM22 (RBM22)
Sign In for Pricing
View Details MBS1307843-03 0.1 mg (E-Coli)
Recombinant Bovine Pre-mRNA-splicing factor RBM22 (RBM22)
Sign In for Pricing
View Details MBS1307843-04 0.1 mg (Yeast)
Recombinant Bovine Pre-mRNA-splicing factor RBM22 (RBM22)
Sign In for Pricing
View Details MBS1307843-05 0.02 mg (Baculovirus)
Recombinant Bovine Pre-mRNA-splicing factor RBM22 (RBM22)
Sign In for Pricing
View Details