Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Product Specifications

Product Name Alternative

(Protein Ly6-D) (Megakaryocyte-enhanced gene transcript 1 protein)

Abbreviation

Recombinant Human LY6G6D protein, partial

Gene Name

LY6G6D

UniProt

O95868

Expression Region

20-104aa

Organism

Homo sapiens (Human)

Target Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.0 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Bub1 Antibody [Alexa Fluor 350]
NBP1-76797AF350 0.1 mL

Rabbit Polyclonal Bub1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
3-Pyrrolin-2-one (~90%)
TRC-P998575-1G 1 g

3-Pyrrolin-2-one (~90%)

Sign In for Pricing
View Details
Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha
MBS1091160-01 0.02 mg (E-Coli)

Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha

Sign In for Pricing
View Details
Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha
MBS1091160-02 0.02 mg (Yeast)

Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha

Sign In for Pricing
View Details
Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha
MBS1091160-03 0.1 mg (E-Coli)

Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha

Sign In for Pricing
View Details
Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha
MBS1091160-04 0.1 mg (Yeast)

Recombinant Homarus americanus Guanine nucleotide-binding protein G (s) subunit alpha

Sign In for Pricing
View Details