Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Bovine (His)

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes. TNF-alpha/TNFSF2 Protein, Bovine (His) is the recombinant bovine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Bovine (His), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-bovine-his.html

Smiles

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Molecular Formula

280943 (Gene_ID) Q06599-1 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag
584517-01 20 µg

Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag

Ask
View Details
Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag
584517-02 100 µg

Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag

Ask
View Details
Vasoactive Intestinal Peptide (VIP) (6-28) (human, bovine, porcine, rat)
MBS659499-01 1 mg

Vasoactive Intestinal Peptide (VIP) (6-28) (human, bovine, porcine, rat)

Ask
View Details
Vasoactive Intestinal Peptide (VIP) (6-28) (human, bovine, porcine, rat)
MBS659499-02 5x 1 mg

Vasoactive Intestinal Peptide (VIP) (6-28) (human, bovine, porcine, rat)

Ask
View Details
Anti-HIST1H2BJ Antibody
CQA6717-01 30 µL

Anti-HIST1H2BJ Antibody

Ask
View Details
Anti-HIST1H2BJ Antibody
CQA6717-02 50 μL

Anti-HIST1H2BJ Antibody

Ask
View Details