Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRG, Human

PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PTPRG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptprg-protein-human.html

Purity

97.00

Smiles

PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN

Molecular Formula

5793 (Gene_ID) P23470 (P820-N1130) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AS160 Recombinant Rabbit monoclonal Antibody
HA751385 100 µL

AS160 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RCOR3 Rabbit Polyclonal Antibody
TA366274 100 µL

RCOR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD14 Antibody[M5E2]
E-AB-F1209C-01 20 Tests

FITC Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
FITC Anti-Human CD14 Antibody[M5E2]
E-AB-F1209C-02 100 Tests

FITC Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
FITC Anti-Human CD14 Antibody[M5E2]
E-AB-F1209C-03 2x 100 Tests

FITC Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)
KN212231RB 1 Kit

SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details