Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRG, Human

PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PTPRG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptprg-protein-human.html

Purity

97.00

Smiles

PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN

Molecular Formula

5793 (Gene_ID) P23470 (P820-N1130) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC50 (NM_014044) Human Over-expression Lysate
LY402272 100 µg

UNC50 (NM_014044) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Esx1 activation kit by CRISPRa
GA201301 1 Kit

Mouse Esx1 activation kit by CRISPRa

Sign In for Pricing
View Details
RuFluor™ succinimidyl ester
1520-AAT 1 mg

RuFluor™ succinimidyl ester

Sign In for Pricing
View Details
C1orf174 (NM_207356) Human Over-expression Lysate
LY403979 100 µg

C1orf174 (NM_207356) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Thymus
CR559743 5 µg

Tissue Total RNA, Thymus

Sign In for Pricing
View Details
Perifosine
TRC-P287380-1MG 1 mg

Perifosine

Sign In for Pricing
View Details