Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRG, Human

PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PTPRG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptprg-protein-human.html

Purity

97.00

Smiles

PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN

Molecular Formula

5793 (Gene_ID) P23470 (P820-N1130) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia Enterocolitica nlpD Protein (aa 1-97)
VAng-Cr2105-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica nlpD Protein (aa 1-97)

Sign In for Pricing
View Details
VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]
AM03029FC-N 50 Tests

VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]

Sign In for Pricing
View Details
TMEM218 Protein Vector (Human) (pPM-C-His)
PV059016 500 ng

TMEM218 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human MYL7, N-His
MBS1574423-01 0.1 mg

Recombinant Human MYL7, N-His

Sign In for Pricing
View Details
Recombinant Human MYL7, N-His
MBS1574423-02 1 mg

Recombinant Human MYL7, N-His

Sign In for Pricing
View Details
Recombinant Human MYL7, N-His
MBS1574423-03 5x 1 mg

Recombinant Human MYL7, N-His

Sign In for Pricing
View Details