Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTFDC1, Human (His)

PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PRTFDC1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtfdc1-protein-human-his.html

Purity

95.60

Smiles

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

Molecular Formula

56952 (Gene_ID) Q9NRG1-1 (M1-V225) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL
BNC040200-100 1x 100 µL

MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin Conjugated TNFRSF14/HVEM Recombinant Rabbit Monoclonal Antibody [PSH06-42]
HA722678B 100 µL

Biotin Conjugated TNFRSF14/HVEM Recombinant Rabbit Monoclonal Antibody [PSH06-42]

Sign In for Pricing
View Details
Recombinant Mouse BMPRIA/ALK-3 Protein (Fc & His Tag)
PKSM041249-01 10 µg

Recombinant Mouse BMPRIA/ALK-3 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Mouse BMPRIA/ALK-3 Protein (Fc & His Tag)
PKSM041249-02 50 µg

Recombinant Mouse BMPRIA/ALK-3 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Calcipressin 1 (RCAN1) Mouse Monoclonal Antibody [Clone ID: OTI10C6]
CF810470 100 µg

Calcipressin 1 (RCAN1) Mouse Monoclonal Antibody [Clone ID: OTI10C6]

Sign In for Pricing
View Details
CDH3 Antibody
8C12101-AAT 50 µg

CDH3 Antibody

Sign In for Pricing
View Details