Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTFDC1, Human (His)

PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PRTFDC1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtfdc1-protein-human-his.html

Purity

95.60

Smiles

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

Molecular Formula

56952 (Gene_ID) Q9NRG1-1 (M1-V225) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl Oxobutyrate
TRC-B693435-250ML 250 mL

tert-Butyl Oxobutyrate

Sign In for Pricing
View Details
Human TM6SF2 activation kit by CRISPRa
GA110005 1 Kit

Human TM6SF2 activation kit by CRISPRa

Sign In for Pricing
View Details
AzoDye-1 Amine
2406-AAT 5 mg

AzoDye-1 Amine

Sign In for Pricing
View Details
RSPO1 Antibody
KC-1817-01 50 μL

RSPO1 Antibody

Sign In for Pricing
View Details
RSPO1 Antibody
KC-1817-02 100 µL

RSPO1 Antibody

Sign In for Pricing
View Details
RSPO1 Antibody
KC-1817-03 1 mL

RSPO1 Antibody

Sign In for Pricing
View Details