Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin A/CSTA, Human (His)

Cystatin A (CSTA) protein is an intracellular thiol protease inhibitor critical for desmosome-mediated intercellular adhesion, especially in the epidermis. Its role as a protease inhibitor is essential for regulating cellular proteolytic activity. Cystatin A/CSTA Protein, Human (His) is the recombinant human-derived Cystatin A/CSTA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin A/CSTA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-a-protein-human-his.html

Purity

98.0

Smiles

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Molecular Formula

1475 (Gene_ID) P01040 (I2-F98) (Accession)

Molecular Weight

Approximately 13-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAD17 (NM_133344) Human Tagged Lenti ORF Clone
RC214722L1 10 µg

RAD17 (NM_133344) Human Tagged Lenti ORF Clone

Ask
View Details
PMVK Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5371R-BF488 100 µL

PMVK Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag
058102-01 10 µg

PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag

Ask
View Details
PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag
058102-02 50 µg

PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag

Ask
View Details
PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag
058102-03 100 µg

PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag

Ask
View Details
PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag
058102-04 200 µg

PR Domain Containing Protein 16 (PRDM16), Recombinant, Human, His-Tag, TRxA-Tag

Ask
View Details