Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin A/CSTA, Human (His)

Cystatin A (CSTA) protein is an intracellular thiol protease inhibitor critical for desmosome-mediated intercellular adhesion, especially in the epidermis. Its role as a protease inhibitor is essential for regulating cellular proteolytic activity. Cystatin A/CSTA Protein, Human (His) is the recombinant human-derived Cystatin A/CSTA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin A/CSTA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-a-protein-human-his.html

Purity

98.0

Smiles

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Molecular Formula

1475 (Gene_ID) P01040 (I2-F98) (Accession)

Molecular Weight

Approximately 13-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MASP1 (NM_001031849) Human Tagged ORF Clone
RG217417 10 µg

MASP1 (NM_001031849) Human Tagged ORF Clone

Ask
View Details
His-Tag (6 His Epitope Tag, Hexa His tag, HHHHHH Epitope Tag, HHHHHH tag, His tag) discontinued
223227-01 50 µL

His-Tag (6 His Epitope Tag, Hexa His tag, HHHHHH Epitope Tag, HHHHHH tag, His tag) discontinued

Ask
View Details
His-Tag (6 His Epitope Tag, Hexa His tag, HHHHHH Epitope Tag, HHHHHH tag, His tag) discontinued
223227-02 100 µL

His-Tag (6 His Epitope Tag, Hexa His tag, HHHHHH Epitope Tag, HHHHHH tag, His tag) discontinued

Ask
View Details
Recombinant Human MLP3B/MAP1LC3B protein (His tag)
PDEH100897-01 20 µg

Recombinant Human MLP3B/MAP1LC3B protein (His tag)

Ask
View Details
Recombinant Human MLP3B/MAP1LC3B protein (His tag)
PDEH100897-02 100 µg

Recombinant Human MLP3B/MAP1LC3B protein (His tag)

Ask
View Details
Recombinant Human MLP3B/MAP1LC3B protein (His tag)
PDEH100897-03 500 µg

Recombinant Human MLP3B/MAP1LC3B protein (His tag)

Ask
View Details