Cystatin A/CSTA, Human (His)
Cystatin A (CSTA) protein is an intracellular thiol protease inhibitor critical for desmosome-mediated intercellular adhesion, especially in the epidermis. Its role as a protease inhibitor is essential for regulating cellular proteolytic activity. Cystatin A/CSTA Protein, Human (His) is the recombinant human-derived Cystatin A/CSTA protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Cystatin A/CSTA Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cystatin-a-protein-human-his.html
Purity
98.0
Smiles
IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Molecular Formula
1475 (Gene_ID) P01040 (I2-F98) (Accession)
Molecular Weight
Approximately 13-14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MARCH6, Control Peptide (E3 Ubiquitin-protein Ligase MARCH6, Doa10 Homolog, Membrane-associated RING Finger Protein 6, Membrane-associated RING-CH Protein VI, MARCH-VI, Protein TEB-4, RING Finger Protein 176, KIAA0597, RNF176, TEB4)
![Mouse Monoclonal Polynuclear Aromatic Hydrocarbons Antibody (BAP-13) [Alexa Fluor 350]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Mouse Monoclonal Polynuclear Aromatic Hydrocarbons Antibody (BAP-13) [Alexa Fluor 350]
![Mouse Monoclonal FLI1 Antibody (FLI1/1312) [Alexa Fluor 647]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Mouse Monoclonal FLI1 Antibody (FLI1/1312) [Alexa Fluor 647]