Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protease serine 2 (Tmprss2), partial

Product Specifications

Product Name Alternative

(Epitheliasin) (Plasmic transmembrane protein X)

Abbreviation

Recombinant Mouse Tmprss2 protein, partial

Gene Name

Tmprss2

UniProt

Q9JIQ8

Expression Region

105-490aa

Organism

Mus musculus (Mouse)

Target Sequence

WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the protease activated receptor-2/F2RL1 or matriptase/ST14 leading to extracellular matrix disruption. In addition, activates trigeminal neurons and contribute to both spontaneous pain and mechanical allodynia.; (Microbial infection) Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9) and is involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.7 kDa

References & Citations

"TMPRSS2, a novel membrane-anchored mediator in cancer pain." Lam D.K., Dang D., Flynn A.N., Hardt M., Schmidt B.L. Pain 156:923-930 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPL18A Antibody [Alexa Fluor 488]
NBP2-97781AF488 0.1 mL

Rabbit Polyclonal RPL18A Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)
MBS1313773-01 0.02 mg (E-Coli)

Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)

Sign In for Pricing
View Details
Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)
MBS1313773-02 0.02 mg (Yeast)

Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)

Sign In for Pricing
View Details
Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)
MBS1313773-03 0.1 mg (E-Coli)

Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)

Sign In for Pricing
View Details
Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)
MBS1313773-04 0.1 mg (Yeast)

Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)

Sign In for Pricing
View Details
Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)
MBS1313773-05 0.02 mg (Baculovirus)

Recombinant Nitrosospira multiformis Histidinol-phosphate aminotransferase 1 (hisC1)

Sign In for Pricing
View Details