Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Mouse (HEK293)

OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Product Specifications

Product Name Alternative

OSM Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-mouse-hek293.html

Purity

95.0

Smiles

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Molecular Formula

18413 (Gene_ID) P53347 (A24-R206) (Accession)

Molecular Weight

Approximately 33.25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKZF1 Human Over-expression Lysate
orb1349363 100 µg

ANKZF1 Human Over-expression Lysate

Sign In for Pricing
View Details
AJAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0064205 3x 1.0 µg

AJAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SLC25A5 Protein Lysate (Human) with C-Ha Tag
44040031 100 µg

SLC25A5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
HB-GL Hybrid Tissue cDNA 5 µmol scale
26-6497-00-06 1 Each

HB-GL Hybrid Tissue cDNA 5 µmol scale

Sign In for Pricing
View Details
Anti-ENPP3/CD203c Antibody (AGS-16C3F antibody)
T9901A-599-01 1 mg

Anti-ENPP3/CD203c Antibody (AGS-16C3F antibody)

Sign In for Pricing
View Details
Anti-ENPP3/CD203c Antibody (AGS-16C3F antibody)
T9901A-599-02 5 mg

Anti-ENPP3/CD203c Antibody (AGS-16C3F antibody)

Sign In for Pricing
View Details