OSM, Mouse (HEK293)
OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.
Product Specifications
Product Name Alternative
OSM Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/osm-protein-mouse-hek293.html
Purity
95.0
Smiles
ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
Molecular Formula
18413 (Gene_ID) P53347 (A24-R206) (Accession)
Molecular Weight
Approximately 33.25 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9335618-01 48 Well
Mouse Exosome complex component CSL4, EXOSC1 ELISA Kit
Sign In for Pricing
View Details MBS9335618-02 96 Well
Mouse Exosome complex component CSL4, EXOSC1 ELISA Kit
Sign In for Pricing
View Details MBS9335618-03 5x 96 Well
Mouse Exosome complex component CSL4, EXOSC1 ELISA Kit
Sign In for Pricing
View Details MBS9335618-04 10x 96 Well
Mouse Exosome complex component CSL4, EXOSC1 ELISA Kit
Sign In for Pricing
View Details