Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Mouse (HEK293)

OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Product Specifications

Product Name Alternative

OSM Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-mouse-hek293.html

Purity

95.0

Smiles

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Molecular Formula

18413 (Gene_ID) P53347 (A24-R206) (Accession)

Molecular Weight

Approximately 33.25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxysterol-binding protein-Related protein 9 (OSBPL9) Human ELISA Kit
F6317 96 Tests

Oxysterol-binding protein-Related protein 9 (OSBPL9) Human ELISA Kit

Sign In for Pricing
View Details
Cis-3-Hexen-1-ol-D5 discontinued
444670-01 2.5 mg

Cis-3-Hexen-1-ol-D5 discontinued

Sign In for Pricing
View Details
Cis-3-Hexen-1-ol-D5 discontinued
444670-02 25 mg

Cis-3-Hexen-1-ol-D5 discontinued

Sign In for Pricing
View Details
Bcat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13214116 3x 1.0 µg

Bcat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Dmrtc1c2 (NM_001142690) Mouse Tagged ORF Clone Lentiviral Particle
MR214979L3V 200 µL

Dmrtc1c2 (NM_001142690) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
APOE4
orb3033360-01 100 µg

APOE4

Sign In for Pricing
View Details