M-CSF, Mouse (HEK293)
M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.
Product Specifications
Product Name Alternative
M-CSF Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-hek293.html
Purity
98.0
Smiles
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Molecular Formula
12977 (Gene_ID) P07141-1 (K33-E262) (Accession)
Molecular Weight
Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MPC3687K Each
Magic™ Membrane Protein Human FUT4 (Fucosyltransferase 4) Full Length
Sign In for Pricing
View Details