Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Canine

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Canine is a recombinant canine IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G26-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-canine.html

Purity

98.00

Smiles

GIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA

Molecular Formula

481837 (Gene_ID) C6L8D7 (G26-A155) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Zhang L, et al. Plasma Erythropoietin, IL-17A, and IFNγ as Potential Biomarkers of Motor Function Recovery in a Canine Model of Spinal Cord Injury. J Mol Neurosci. 2020 Nov;70 (11) :1821-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab27b (BC018443) Mouse Tagged ORF Clone
MG201117 10 µg

Rab27b (BC018443) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)
KN209129BN 1 Kit

gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL24 (NM_000986) Human Over-expression Lysate
LY424416 100 µg

RPL24 (NM_000986) Human Over-expression Lysate

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF740 conjugate, 0.1mg/mL
BNC743132-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat ApoA1 (Apolipoprotein A1) CLIA Kit
E-CL-R0710-01 24 Tests

Rat ApoA1 (Apolipoprotein A1) CLIA Kit

Sign In for Pricing
View Details
Rat ApoA1 (Apolipoprotein A1) CLIA Kit
E-CL-R0710-02 48 Tests

Rat ApoA1 (Apolipoprotein A1) CLIA Kit

Sign In for Pricing
View Details