Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Canine

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Canine is a recombinant canine IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G26-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-canine.html

Purity

98.00

Smiles

GIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA

Molecular Formula

481837 (Gene_ID) C6L8D7 (G26-A155) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Zhang L, et al. Plasma Erythropoietin, IL-17A, and IFNγ as Potential Biomarkers of Motor Function Recovery in a Canine Model of Spinal Cord Injury. J Mol Neurosci. 2020 Nov;70 (11) :1821-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PR3 Antibody
OC-686-01 50 μL

PR3 Antibody

Sign In for Pricing
View Details
PR3 Antibody
OC-686-02 100 µL

PR3 Antibody

Sign In for Pricing
View Details
PR3 Antibody
OC-686-03 1 mL

PR3 Antibody

Sign In for Pricing
View Details
PVRL1 (NECTIN1) Human Gene Knockout Kit (CRISPR)
KN211214 1 Kit

PVRL1 (NECTIN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RIPPLY3 (NM_018962) Human Recombinant Protein
TP313078M 100 µg

RIPPLY3 (NM_018962) Human Recombinant Protein

Sign In for Pricing
View Details
NEK2 Polyclonal Antibody
E-AB-90632-01 60 µL

NEK2 Polyclonal Antibody

Sign In for Pricing
View Details