IFN-gamma, Mouse (HEK293, His)

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Molecular Formula

15978 (Gene_ID) P01580 (H23-C155) (Accession)

Molecular Weight

Approximately 15-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huang S, et al. Immune response in mice that lack the interferon-gamma receptor. Science. 1993 Mar 19;259 (5102) :1742-5.|[2]Pearl JE, et al. Inflammation and lymphocyte activation during mycobacterial infection in the interferon-gamma-deficient mouse. Cell Immunol. 2001 Jul 10;211 (1) :43-50.|[3]Baldridge MT, et al. Quiescent haematopoietic stem cells are activated by IFN-gamma in response to chronic infection. Nature. 2010 Jun 10;465 (7299) :793-7.|[4]Matatall KA, et al. Type II interferon promotes differentiation of myeloid-biased hematopoietic stem cells. Stem Cells. 2014 Nov;32 (11) :3023-30.|[5]Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81.|[6]Kak G, et al. Interferon-gamma (IFN-γ) : Exploring its implications in infectious diseases. Biomol Concepts. 2018 May 30;9 (1) :64-79.|[7]Afkarian M, et al. T-bet is a STAT1-induced regulator of IL-12R expression in naïve CD4+ T cells. Nat Immunol. 2002 Jun;3 (6) :549-57.|[8]Schroder K, et al. Interferon-gamma: an overview of signals, mechanisms and functions. J Leukoc Biol. 2004 Feb;75 (2) :163-89.