Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Mouse (His, solution)

FGF-9 Protein, Mouse (His, solution) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

Product Specifications

Product Name Alternative

FGF-9 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse.html

Purity

98.0

Smiles

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

14180 (Gene_ID) P54130 (M1-S208) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yusuf IO, et al. Fibroblast Growth Factor 9 Suppresses Striatal Cell Death Dominantly Through ERK Signaling in Huntington's Disease. Cell Physiol Biochem. 2018;48 (2) :605-617.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-CL Assay Kit
OM626116 100 Tests

S-CL Assay Kit

Sign In for Pricing
View Details
DRD2 Recombinant Protein (Human)
RP009826 100 µg

DRD2 Recombinant Protein (Human)

Sign In for Pricing
View Details
EHMT2 3'UTR GFP Stable Cell Line
TU056692 1.0 mL

EHMT2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Enoxaparin sodium
FE61518-01 1 g

Enoxaparin sodium

Sign In for Pricing
View Details
Enoxaparin sodium
FE61518-02 2 g

Enoxaparin sodium

Sign In for Pricing
View Details
Enoxaparin sodium
FE61518-03 5 g

Enoxaparin sodium

Sign In for Pricing
View Details