Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Mouse (His, solution)

FGF-9 Protein, Mouse (His, solution) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

Product Specifications

Product Name Alternative

FGF-9 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse.html

Purity

98.0

Smiles

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

14180 (Gene_ID) P54130 (M1-S208) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yusuf IO, et al. Fibroblast Growth Factor 9 Suppresses Striatal Cell Death Dominantly Through ERK Signaling in Huntington's Disease. Cell Physiol Biochem. 2018;48 (2) :605-617.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nudt8 Pre-designed siRNA Set A
SI109695A 1 Each

Mouse Nudt8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Defb19 Peptide
orb1235567 0.1 mg

Defb19 Peptide

Sign In for Pricing
View Details
BSX siRNA (Human)
MBS8233990-01 15 nmol

BSX siRNA (Human)

Sign In for Pricing
View Details
BSX siRNA (Human)
MBS8233990-02 30 nmol

BSX siRNA (Human)

Sign In for Pricing
View Details
BSX siRNA (Human)
MBS8233990-03 5x 30 nmol

BSX siRNA (Human)

Sign In for Pricing
View Details
4-{[Benzyl (methyl) amino]methyl}-N-methylpyridin-2-amine
HBC37035-01 50 mg

4-{[Benzyl (methyl) amino]methyl}-N-methylpyridin-2-amine

Sign In for Pricing
View Details