Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxiredoxin-6 (Prdx6)

Product Specifications

Product Name Alternative

1-Cys peroxiredoxin;1-Cys PRX; Acidic calcium-independent phospholipase A2; aiPLA2; EC 3.1.1.4; Antioxidant protein 2; Glutathione-dependent peroxiredoxin; Lysophosphatidylcholine acyltransferase 5; LPC acyltransferase 5; LPCAT-5; Lyso-PC acyltransferase 5; EC 2.3.1.23; Non-selenium glutathione peroxidase; NSGPx

Abbreviation

Recombinant Mouse Prdx6 protein

Gene Name

Prdx6

UniProt

O08709

Expression Region

2-224aa

Organism

Mus musculus (Mouse)

Target Sequence

PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Can reduce H (2) O (2) and short chain organic, fatty acid, and phospholipid hydroperoxides. Has phospholipase activity. Can either reduce the oxidized sn-2 fatty acyl group of phospholipids (peroxidase activity) or hydrolyze the sn-2 ester bond of phospholipids (phospholipase activity) . These activities are dependent on binding to phospholipids at acidic pH and to oxidized phospholipds at cytosolic pH. Plays a role in cell protection against oxidative stress by detoxifying peroxides and in phospholipid homeostasis. Exhibits acyl-CoA-dependent lysophospholipid acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) . Shows a clear preference for LPC as the lysophospholipid and for palmitoyl CoA as the fatty acyl substrate.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinol Binding Protein (RBP) Multi-Format ELISA Kit
K062-H5 5 Plates

Retinol Binding Protein (RBP) Multi-Format ELISA Kit

Sign In for Pricing
View Details
Zfp457 Mouse Gene Knockout Kit (CRISPR)
KN519846 1 Kit

Zfp457 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(±)-Propylene Oxide
TRC-P835241-500ML 500 mL

(±)-Propylene Oxide

Sign In for Pricing
View Details
Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-01 24 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details
Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-02 48 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details
Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-03 96 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details