Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Cynomolgus/Rhesus Macaque (HEK293, His)

The CD81 protein is a member of the growth hormone/prolactin family and regulates a variety of physiological processes. Prolactin is mainly associated with mammary gland development and lactation, has pleiotropic effects, and affects immune responses, metabolism, and behavior. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque/Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

98.00

Smiles

KDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLAALTTSVLKNNLCPSGSNIISNLLKKDCHQKIDELFSGK

Molecular Formula

102139656 (Gene_ID) A0A2K5UDJ9 (K116-K201) (Accession)

Molecular Weight

Approximately 10 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 Antibody
orb2637537 100 µg

CD147 Antibody

Sign In for Pricing
View Details
Phospho-Chk2 (Thr68) Rabbit mAb
F0243-100uL*2 2x 100 μL

Phospho-Chk2 (Thr68) Rabbit mAb

Sign In for Pricing
View Details
TTBK1 Conjugated Antibody
C43428 100 µL

TTBK1 Conjugated Antibody

Sign In for Pricing
View Details
Human Hypothetical protein LOC677168 ELISA Kit
201-12-1870 96 Tests

Human Hypothetical protein LOC677168 ELISA Kit

Sign In for Pricing
View Details
RGD1561226 Recombinant Protein (Rat)
RP225278 100 µg

RGD1561226 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Anti-P2RX1 Antibody Picoband®
A07497-2-carrier-free 100 µg/Vial

Anti-P2RX1 Antibody Picoband®

Sign In for Pricing
View Details