Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR1, Human (P.pastoris, His)

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBR1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbr1-human-p-pastoris-his.html

Purity

90.00

Smiles

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Molecular Formula

873 (Gene_ID) P16152 (S2-W277) (Accession)

Molecular Weight

Approximately 33.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Thyroid Stimulating Hormone (TSH, Thyroid-stimulating Hormone alpha Chain, TSH alpha, TSH A, TSHA, Thyroid-stimulating Hormone beta, Thyroid-stimulating Hormone beta Subunit, Thyroid-stimulating Hormone Subunit beta, TSH beta, TSH B, TSHB, TSH-B, Thyrotropin alfa, Thyrotropin alpha Chain, Thyrotropin beta Subunit, Thyrotropin Subunit beta) discontinued
T5400-42C 5 mL

Thyroid Stimulating Hormone (TSH, Thyroid-stimulating Hormone alpha Chain, TSH alpha, TSH A, TSHA, Thyroid-stimulating Hormone beta, Thyroid-stimulating Hormone beta Subunit, Thyroid-stimulating Hormone Subunit beta, TSH beta, TSH B, TSHB, TSH-B, Thyrotropin alfa, Thyrotropin alpha Chain, Thyrotropin beta Subunit, Thyrotropin Subunit beta) discontinued

Ask
View Details
Mouse Kallikrein 2 ELISA Kit
MBS080552-01 48 Well

Mouse Kallikrein 2 ELISA Kit

Ask
View Details
Mouse Kallikrein 2 ELISA Kit
MBS080552-02 96 Well

Mouse Kallikrein 2 ELISA Kit

Ask
View Details
Mouse Kallikrein 2 ELISA Kit
MBS080552-03 5x 96 Well

Mouse Kallikrein 2 ELISA Kit

Ask
View Details
Mouse Kallikrein 2 ELISA Kit
MBS080552-04 10x 96 Well

Mouse Kallikrein 2 ELISA Kit

Ask
View Details
ARHGAP25 antibody
10R-3365 100 ul

ARHGAP25 antibody

Ask
View Details