Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum C phage Hemagglutinin components HA-70 type C (HA-70)

Product Specifications

Product Name Alternative

HA3; Hemagglutinin components HA-22/23/53 type C; Hemagglutinin components HA-22/23/53 type C1; HA3b

Abbreviation

Recombinant Clostridium botulinum C phage HA-70 protein

Gene Name

HA-70

UniProt

P46085

Expression Region

7-192aa

Organism

Clostridium botulinum C phage (Clostridium botulinum C bacteriophage)

Target Sequence

ELYYTKDKSINNVNLADGNYVVNRGDGWILSRQNQNLGGNISNNGCTAIVGDLRIRETATPYYYPTASFNEEYIKNNVQNVFANFTEASEIPIGFEFSKTAPSNKSLYMYLQYTYIRYEIIKVLQNTVTERAVLYVPSLGYVKSIEFNSEEQIDKNFYFTSQDKCILNEKFIYKKIDDTITVKESK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

The hemagglutinin (HA) component of the progenitor toxin protects the structural integrity of botulinum neurotoxin; may increase internalization of the neurotoxin into the bloodstream of the host. The HA component is involved in binding to the upper small intestine through interactions with glycolipids and glycoproteins containing sialic acid moieties (Probable) . Whole protein and the HA-53 chain (but not the HA-22-23 chain) bind to bovine mucin; if the mucin is pretreated with neuraminidase (removes the terminal sialic acid of glycoconjugates) mucin binding is decreased. Has higher affinity for alpha-2,3-sialylated oligosaccharides than alpha-2-6 sialylated oligosaccharides.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc35b3 Mouse Gene Knockout Kit (CRISPR)
KN516061 1 Kit

Slc35b3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PHD3 Rabbit mAb
E45R11366N-100 100 µL

PHD3 Rabbit mAb

Sign In for Pricing
View Details
Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)
MBS9511760-01 3 mL (RTU)

Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)
MBS9511760-02 6 mL (RTU)

Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)
MBS9511760-03 12 mL (RTU)

Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)
MBS9511760-04 5x 12 mL (RTU)

Anti-Human Villin (ABT097) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details