Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 9 (Fgf9) (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 9; FGF-9; Glia-activating factor; GAF; heparin-binding growth factor-9; HBGF-9; Fgf9; Fgf-9

Abbreviation

Recombinant Mouse Fgf9 protein (Active)

Gene Name

Fgf9

UniProt

P54130

Expression Region

1-208aa

Organism

Mus musculus (Mouse)

Target Sequence

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes .It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml.

Form

Liquid

Buffer

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5

Function

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenoxyethyl-2,2’-thenylaminoethane, Hydrochloride
TRC-P299450-500MG 500 mg

2-Phenoxyethyl-2,2’-thenylaminoethane, Hydrochloride

Sign In for Pricing
View Details
rac 2-Palmitoyl-3-chloropropanediol
TRC-P156510-5MG 5 mg

rac 2-Palmitoyl-3-chloropropanediol

Sign In for Pricing
View Details
KCTD12 Rabbit Polyclonal Antibody
TA361474 100 µL

KCTD12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDH1 (C-term) Rabbit Polyclonal Antibody
AP17556PU-N 400 µL

MDH1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTPRD Rabbit Polyclonal Antibody
TA380543 100 µL

PTPRD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMF Antibody
KC-144-01 50 μL

AMF Antibody

Sign In for Pricing
View Details