Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase M-type/CKM, Human (His)

Creatine kinase M-type/CKM Protein, Human (His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

Creatine kinase M-type/CKM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-m-type-protein-human-his.html

Purity

98.0

Smiles

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Formula

1158 (Gene_ID) AAH07462.1 (M1-K381) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit GADL1 (Glutamate Decarboxylase Like Protein 1) ValidElisa Kit
EK347080 96 Well

Rabbit GADL1 (Glutamate Decarboxylase Like Protein 1) ValidElisa Kit

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein M (APOM)
MBS2001617-01 0.1 mL

Polyclonal Antibody to Apolipoprotein M (APOM)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein M (APOM)
MBS2001617-02 0.2 mL

Polyclonal Antibody to Apolipoprotein M (APOM)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein M (APOM)
MBS2001617-03 0.5 mL

Polyclonal Antibody to Apolipoprotein M (APOM)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein M (APOM)
MBS2001617-04 1 mL

Polyclonal Antibody to Apolipoprotein M (APOM)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein M (APOM)
MBS2001617-05 5 mL

Polyclonal Antibody to Apolipoprotein M (APOM)

Sign In for Pricing
View Details