Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/high-mobility-group-protein-b1-protein-human.html

Purity

98.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

Molecular Formula

3146 (Gene_ID) P09429 (M1-F89) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF15/MIC1 Rabbit Polyclonal Antibody
orb2952123-01 50 µg

GDF15/MIC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GDF15/MIC1 Rabbit Polyclonal Antibody
orb2952123-02 100 µg

GDF15/MIC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIM 4 (TIMD4) (NM_138379) Human Tagged ORF Clone Lentiviral Particle
RC203848L2V 200 µL

TIM 4 (TIMD4) (NM_138379) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CMH3 AAV siRNA Pooled Vector
55658161 1.0 µg

CMH3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Fam173b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
19840116 3x 1.0 µg

Fam173b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Znfx1 (NM_001291162) Mouse Tagged ORF Clone
MR231519 10 µg

Znfx1 (NM_001291162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details