Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRP1, Human (His)

The CSRP1 protein is a protein that may be involved in neuronal development. It is known to interact with three other proteins: ASCC1, ASCC2 and TRIP4. CSRP1 Protein, Human (His) is the recombinant human-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

CSRP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csrp1-protein-human-his.html

Purity

98.0

Smiles

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

Molecular Formula

1465 (Gene_ID) P21291 (M1-E193) (Accession)

Molecular Weight

Approximately 22 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit
MBS7248167-01 48 Well

Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit
MBS7248167-02 96 Well

Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit
MBS7248167-03 5x 96 Well

Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit
MBS7248167-04 10x 96 Well

Human Actin related protein 2/3 complex subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Trim9-set siRNA/shRNA/RNAi Lentivector (Rat)
47850096 4x 500 ng

Trim9-set siRNA/shRNA/RNAi Lentivector (Rat)

Ask
View Details
HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588) (MaxLight 490)
127770-ML490 100 µL

HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588) (MaxLight 490)

Ask
View Details